PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g012630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 810aa    MW: 91876.5 Da    PI: 4.5659
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g012630.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox352.4e-11463507953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     k  +e L ++F++n  ps++ r +L+k+l+L+ ++V+ WF+N R+
  Csa10g012630.1 463 KAAVEKLRKVFAENELPSKDVRDRLSKELSLDPEKVSKWFKNTRY 507
                     677899*************************************97 PP

2PHD42.21.9e-14195250151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+++fH+kCl+++le+e++p g   w+C+ C++k
  Csa10g012630.1 195 FCAECNSreAFPDNDIILCDgTCNRAFHQKCLDPPLETESIPPGvqGWFCKFCDCK 250
                     6999***55455********56*******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.57E-14187252IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.3E-12191250IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.709193250IPR019787Zinc finger, PHD-finger
CDDcd155041.60E-29195247No hitNo description
SMARTSM002494.2E-9195248IPR001965Zinc finger, PHD-type
PfamPF006281.3E-11195250IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590196247IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.602.6E-12450506IPR009057Homeodomain-like
SuperFamilySSF466896.42E-11451515IPR009057Homeodomain-like
PROSITE profilePS5007113.297452512IPR001356Homeobox domain
SMARTSM003894.0E-12454516IPR001356Homeobox domain
CDDcd000862.09E-9455507No hitNo description
PfamPF000468.6E-9463507IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MEESETKGRI RRETEKACVS VERIGSTLLS PLAKKGKDTS NKRNPKPNKR KAEEEICSKS  60
RNKKCTRGRV HCEEEEEEEE EKGKKTRKRK SKRQQKDNKV EVDDSLRLQR RTRYLLIKMK  120
MQQNLIDAYA TEGWKGQSRE KIRPDKELER ARKEILNCKL GLRDAIRQLD LLSSVGSMED  180
KVIALDGSIH HDHIFCAECN SREAFPDNDI ILCDGTCNRA FHQKCLDPPL ETESIPPGVQ  240
GWFCKFCDCK MEIIDTMNAQ IGTHFPADSN WQDIFKEEAS LPIGSEATVN NEADWPSDDS  300
KDDDYDPEMR ENGGGSSSNF SGGGGGDNDG ESISTSLSSD GVALSTGSWE GHGFNNMVEQ  360
CETSNEEAVC GPRQRRTVDY TKLYYEMFGK DAVLQEQGSE DEDWGPNDRR KRRKESDVTS  420
ELVNMCESSK KDQDAVQIPE QRKRDFVSVE NKGGRRPMFR LPKAAVEKLR KVFAENELPS  480
KDVRDRLSKE LSLDPEKVSK WFKNTRYMAL RNRKTESEKQ PEHCKTVSER DSGPEAVMKN  540
NTDTKQTQNT LDETEVPEDL KTVSSEDSGP EAVMENDTNE VQDTLDETFP PGFDDLATSQ  600
KINSPCNNSP EIPEDLKTVS GGDSEQEAVM ENDTNEVQDS LDETFPPGFN DLAANQKILS  660
PCNNNQEETQ QANVSFPAPT DEIQQYLEQN DSSFALVPHE ELSSEMSLKT VVEERERQRP  720
HEELSSEMSL NTAEEEEETD SKITEEEEYE AVMEMLCRTK NKLLDVTQRL ERFKTPKGRK  780
KLGKCSSLSE EDSVVYVPIV EVMEKKENN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18590TRKRKS
2409414RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHPRHA0.0L21991.1 Arabidopsis thaliana homeodomain protein (PRHA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438239.10.0PREDICTED: pathogenesis-related homeodomain protein isoform X1
SwissprotP487850.0PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLR0F3V50.0R0F3V5_9BRAS; Uncharacterized protein
STRINGscaffold_701235.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.10.0pathogenesis related homeodomain protein A